PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA003095-PA
Common NameOsI_01067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 866aa    MW: 95244.7 Da    PI: 6.4703
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA003095-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.71.1e-28520571152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  BGIOSGA003095-PA 520 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 571
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.473510591IPR003035RWP-RK domain
PfamPF020425.9E-26523571IPR003035RWP-RK domain
SuperFamilySSF542772.13E-21762857No hitNo description
PfamPF005641.6E-15772853IPR000270PB1 domain
SMARTSM006667.4E-25772854IPR000270PB1 domain
PROSITE profilePS5174518.698772854IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.8E-25772853No hitNo description
CDDcd064071.45E-33773853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 866 aa     Download sequence    Send to blast
MGAPAAPATA PPAEAAAVVE EVHRTRSGNS DTTSKRVDQI NSKWQFHLSI DDNTDSSCLF  60
KERLTQALRY FKESTDQHLL VQVWAPVKSG DRYVLTTSGQ PFVLDQQSIG LLQYRAVSMM  120
YMFSVDGENA GELGLPGRVY KQKVPEWTPN VQYYSSTEYP RLNHAISYNV HGTVALPVFD  180
PSVQNCIAVV ELIMTSKKIN YAGEVDKVCK ALEAVNLKST EILDHPNVQI CNEGRQSALV  240
EILEILTVVC EEHKLPLAQT WVPCKYRSVL AHGGGVKKSC LSFDGSCMGE VCMSTSDVAF  300
HVIDAHMWGF RDACVEHHLQ KGQGVSGKAF IYRRPCFSKD ISQFCKLEYP LVHYARMFGL  360
AGCFAICLQS MYTGDDDYIL EFFLPPNCRN EDDQNALLES ILARMKKCLR TLKVVGNGDT  420
NEVCLQISNV LIIETEDLKT NVHFENSEGC FRESPESNGS QRAHEVDNDG NKISIMSERH  480
LLADDNSQNN GASVGRPNGS GASDSLHKSN KPPERRRGKA EKTISLDVLQ QYFSGSLKNA  540
AKSLGVCPTT MKRICRQHGI SRWPSRKINK VNRSLSKLKQ VIESVQGSDA SFNLTSITGP  600
LPIPVGPSSD SQNLEKASPN KVAELSNLAV EGDRDSSLQK PIENDNLAIL MSQQGFIDAN  660
NNLQLEADKA SHSRSSSGEG SINSRTSEAS CQGSPANQTF VCKPIASTFA EPQLIPEAFT  720
KEPFQEPALP LSRMLIEDSG SSKDLKNLFT SAVDQPFLAR SSNLALMQNS GTVTIKASFK  780
EDIVRFRFPC SGSVTALKDE VAKRLRMDVG MFDIKYLDDD HEWVKLACNA DLEECMEISR  840
HSGSHVIRLL VSDVAAHLGS SCGSSG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.38380.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154355430.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613020.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA2WMJ90.0A2WMJ9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA003095-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7